2.50 Rating by CuteStat

watchadvancedhighlythefile.vip is 2 years 9 months old. It is a domain having vip extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, watchadvancedhighlythefile.vip is SAFE to browse.

PageSpeed Score
0
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: Not Applicable
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

44.196.130.32

Hosted Country:

United States of America US

Location Latitude:

39.0469

Location Longitude:

-77.4903

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 1 H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: Not Applicable
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 44.196.130.32)

404 Not Found

- watchrefinedextremelythefile.vip
8,522,595 $ 240.00

404 Not Found

- watchsophisticatedextremelythefile.vip
8,142,486 $ 240.00

404 Not Found

- watchspeedyextremelythefile.vip
5,251,881 $ 240.00

404 Not Found

- watchstrongextremelythefile.vip
Not Applicable $ 8.95

404 Not Found

- watchswiftextremelythefile.vip
Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 404 Not Found
Date: Fri, 30 Jul 2021 21:32:15 GMT
Content-Type: text/html
Content-Length: 552
Connection: keep-alive
Server: nginx

Domain Information

Domain Registrar: NAMECHEAP INC
Registration Date: Jul 29, 2021, 3:02 PM 2 years 9 months 2 weeks ago
Expiration Date: Jul 29, 2022, 3:02 PM 1 year 9 months 2 weeks ago
Domain Status:
clienttransferprohibited
addperiod

Domain Nameserver Information

Host IP Address Country
dns1.registrar-servers.com 156.154.132.200 United States of America United States of America
dns2.registrar-servers.com 156.154.133.200 United States of America United States of America

DNS Record Analysis

Host Type TTL Extra
watchadvancedhighlythefile.vip A 57 IP: 44.196.130.32
watchadvancedhighlythefile.vip NS 1800 Target: dns1.registrar-servers.com
watchadvancedhighlythefile.vip NS 1800 Target: dns2.registrar-servers.com
watchadvancedhighlythefile.vip SOA 3601 MNAME: dns1.registrar-servers.com
RNAME: hostmaster.registrar-servers.com
Serial: 1627550238
Refresh: 43200
Retry: 3600
Expire: 604800
Minimum TTL: 3601
watchadvancedhighlythefile.vip MX 1800 Priority: 20
Target: eforward5.registrar-servers.com
watchadvancedhighlythefile.vip MX 1800 Priority: 15
Target: eforward4.registrar-servers.com
watchadvancedhighlythefile.vip MX 1800 Priority: 10
Target: eforward1.registrar-servers.com
watchadvancedhighlythefile.vip MX 1800 Priority: 10
Target: eforward2.registrar-servers.com
watchadvancedhighlythefile.vip MX 1800 Priority: 10
Target: eforward3.registrar-servers.com
watchadvancedhighlythefile.vip TXT 1800 TXT: v=spf1
include:spf.efwd.registrar-servers.com
~all

Full WHOIS Lookup

Domain name: watchadvancedhighlythefile.vip
Registry Domain ID: D_0228C98F_F9D480D6969A4FC1B32C053F251CA963_0000017AF18DAF6B-VIP
Registrar WHOIS Server: whois.namecheap.com
Registrar URL: http://www.namecheap.com
Updated Date: 0001-01-01T00:00:00.00Z
Creation Date: 2021-07-29T09:17:12.42Z
Registrar Registration Expiration Date: 2022-07-29T09:17:12.42Z
Registrar: NAMECHEAP INC
Registrar IANA ID: 1068
Registrar Abuse Contact Email: abuse@namecheap.com
Registrar Abuse Contact Phone: +1.6613102107
Reseller: NAMECHEAP INC
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: addPeriod https://icann.org/epp#addPeriod
Registry Registrant ID:
Registrant Name: Withheld for Privacy Purposes
Registrant Organization: Privacy service provided by Withheld for Privacy ehf
Registrant Street: Kalkofnsvegur 2
Registrant City: Reykjavik
Registrant State/Province: Capital Region
Registrant Postal Code: 101
Registrant Country: IS
Registrant Phone: +354.4212434
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: 5face7bcf7af457a880050c39f30a6f3.protect@withheldforprivacy.com
Registry Admin ID:
Admin Name: Withheld for Privacy Purposes
Admin Organization: Privacy service provided by Withheld for Privacy ehf
Admin Street: Kalkofnsvegur 2
Admin City: Reykjavik
Admin State/Province: Capital Region
Admin Postal Code: 101
Admin Country: IS
Admin Phone: +354.4212434
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: 5face7bcf7af457a880050c39f30a6f3.protect@withheldforprivacy.com
Registry Tech ID:
Tech Name: Withheld for Privacy Purposes
Tech Organization: Privacy service provided by Withheld for Privacy ehf
Tech Street: Kalkofnsvegur 2
Tech City: Reykjavik
Tech State/Province: Capital Region
Tech Postal Code: 101
Tech Country: IS
Tech Phone: +354.4212434
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: 5face7bcf7af457a880050c39f30a6f3.protect@withheldforprivacy.com
Name Server: dns1.registrar-servers.com
Name Server: dns2.registrar-servers.com
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2021-07-30T13:32:25.57Z <<<
For more information on Whois status codes, please visit https://icann.org/epp