Web Analysis for Watchadvancedhighlythefile - watchadvancedhighlythefile.vip
2.50
Rating by CuteStat
watchadvancedhighlythefile.vip is 2 years 9 months old. It is a domain having vip extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, watchadvancedhighlythefile.vip is SAFE to browse.
PageSpeed Score
0
Siteadvisor Rating
Not Applicable
Traffic Report
Daily Unique Visitors: | Not Applicable |
Daily Pageviews: | Not Applicable |
Estimated Valuation
Income Per Day: | $ 0.15 |
Estimated Worth: | $ 8.95 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | Not Applicable |
Bing Backlinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Alexa Rank: | Not Applicable |
Domain Authority: | Not Applicable |
Web Server Information
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | 1 | H2 Headings: | Not Applicable |
H3 Headings: | Not Applicable | H4 Headings: | Not Applicable |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | Not Applicable | Total Images: | Not Applicable |
Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 44.196.130.32)
HTTP Header Analysis
HTTP/1.1 404 Not Found
Date: Fri, 30 Jul 2021 21:32:15 GMT
Content-Type: text/html
Content-Length: 552
Connection: keep-alive
Server: nginx
Date: Fri, 30 Jul 2021 21:32:15 GMT
Content-Type: text/html
Content-Length: 552
Connection: keep-alive
Server: nginx
Domain Information
Domain Nameserver Information
Host | IP Address | Country | |
---|---|---|---|
dns1.registrar-servers.com | 156.154.132.200 | United States of America | |
dns2.registrar-servers.com | 156.154.133.200 | United States of America |
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
watchadvancedhighlythefile.vip | A | 57 |
IP: 44.196.130.32 |
watchadvancedhighlythefile.vip | NS | 1800 |
Target: dns1.registrar-servers.com |
watchadvancedhighlythefile.vip | NS | 1800 |
Target: dns2.registrar-servers.com |
watchadvancedhighlythefile.vip | SOA | 3601 |
MNAME: dns1.registrar-servers.com RNAME: hostmaster.registrar-servers.com Serial: 1627550238 Refresh: 43200 Retry: 3600 Expire: 604800 Minimum TTL: 3601 |
watchadvancedhighlythefile.vip | MX | 1800 |
Priority: 20 Target: eforward5.registrar-servers.com |
watchadvancedhighlythefile.vip | MX | 1800 |
Priority: 15 Target: eforward4.registrar-servers.com |
watchadvancedhighlythefile.vip | MX | 1800 |
Priority: 10 Target: eforward1.registrar-servers.com |
watchadvancedhighlythefile.vip | MX | 1800 |
Priority: 10 Target: eforward2.registrar-servers.com |
watchadvancedhighlythefile.vip | MX | 1800 |
Priority: 10 Target: eforward3.registrar-servers.com |
watchadvancedhighlythefile.vip | TXT | 1800 |
TXT: v=spf1 include:spf.efwd.registrar-servers.com ~all |
Full WHOIS Lookup
Domain name: watchadvancedhighlythefile.vip
Registry Domain ID: D_0228C98F_F9D480D6969A4FC1B32C053F251CA963_0000017AF18DAF6B-VIP
Registrar WHOIS Server: whois.namecheap.com
Registrar URL: http://www.namecheap.com
Updated Date: 0001-01-01T00:00:00.00Z
Creation Date: 2021-07-29T09:17:12.42Z
Registrar Registration Expiration Date: 2022-07-29T09:17:12.42Z
Registrar: NAMECHEAP INC
Registrar IANA ID: 1068
Registrar Abuse Contact Email: abuse@namecheap.com
Registrar Abuse Contact Phone: +1.6613102107
Reseller: NAMECHEAP INC
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: addPeriod https://icann.org/epp#addPeriod
Registry Registrant ID:
Registrant Name: Withheld for Privacy Purposes
Registrant Organization: Privacy service provided by Withheld for Privacy ehf
Registrant Street: Kalkofnsvegur 2
Registrant City: Reykjavik
Registrant State/Province: Capital Region
Registrant Postal Code: 101
Registrant Country: IS
Registrant Phone: +354.4212434
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: 5face7bcf7af457a880050c39f30a6f3.protect@withheldforprivacy.com
Registry Admin ID:
Admin Name: Withheld for Privacy Purposes
Admin Organization: Privacy service provided by Withheld for Privacy ehf
Admin Street: Kalkofnsvegur 2
Admin City: Reykjavik
Admin State/Province: Capital Region
Admin Postal Code: 101
Admin Country: IS
Admin Phone: +354.4212434
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: 5face7bcf7af457a880050c39f30a6f3.protect@withheldforprivacy.com
Registry Tech ID:
Tech Name: Withheld for Privacy Purposes
Tech Organization: Privacy service provided by Withheld for Privacy ehf
Tech Street: Kalkofnsvegur 2
Tech City: Reykjavik
Tech State/Province: Capital Region
Tech Postal Code: 101
Tech Country: IS
Tech Phone: +354.4212434
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: 5face7bcf7af457a880050c39f30a6f3.protect@withheldforprivacy.com
Name Server: dns1.registrar-servers.com
Name Server: dns2.registrar-servers.com
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2021-07-30T13:32:25.57Z <<<
For more information on Whois status codes, please visit https://icann.org/epp
Registry Domain ID: D_0228C98F_F9D480D6969A4FC1B32C053F251CA963_0000017AF18DAF6B-VIP
Registrar WHOIS Server: whois.namecheap.com
Registrar URL: http://www.namecheap.com
Updated Date: 0001-01-01T00:00:00.00Z
Creation Date: 2021-07-29T09:17:12.42Z
Registrar Registration Expiration Date: 2022-07-29T09:17:12.42Z
Registrar: NAMECHEAP INC
Registrar IANA ID: 1068
Registrar Abuse Contact Email: abuse@namecheap.com
Registrar Abuse Contact Phone: +1.6613102107
Reseller: NAMECHEAP INC
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: addPeriod https://icann.org/epp#addPeriod
Registry Registrant ID:
Registrant Name: Withheld for Privacy Purposes
Registrant Organization: Privacy service provided by Withheld for Privacy ehf
Registrant Street: Kalkofnsvegur 2
Registrant City: Reykjavik
Registrant State/Province: Capital Region
Registrant Postal Code: 101
Registrant Country: IS
Registrant Phone: +354.4212434
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: 5face7bcf7af457a880050c39f30a6f3.protect@withheldforprivacy.com
Registry Admin ID:
Admin Name: Withheld for Privacy Purposes
Admin Organization: Privacy service provided by Withheld for Privacy ehf
Admin Street: Kalkofnsvegur 2
Admin City: Reykjavik
Admin State/Province: Capital Region
Admin Postal Code: 101
Admin Country: IS
Admin Phone: +354.4212434
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: 5face7bcf7af457a880050c39f30a6f3.protect@withheldforprivacy.com
Registry Tech ID:
Tech Name: Withheld for Privacy Purposes
Tech Organization: Privacy service provided by Withheld for Privacy ehf
Tech Street: Kalkofnsvegur 2
Tech City: Reykjavik
Tech State/Province: Capital Region
Tech Postal Code: 101
Tech Country: IS
Tech Phone: +354.4212434
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: 5face7bcf7af457a880050c39f30a6f3.protect@withheldforprivacy.com
Name Server: dns1.registrar-servers.com
Name Server: dns2.registrar-servers.com
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2021-07-30T13:32:25.57Z <<<
For more information on Whois status codes, please visit https://icann.org/epp